Daily Hints for Today's Puzzles

Popular Tools

Anagram SolverAI Anagram SolverAI Word Problem SolverBoard SolverHangman SolverCryptogram SolverScrabble Word FinderCrossword SolverWordle SolverName Anagram GeneratorEmoji TranslatorPhrase UnscramblerWordscapes SolverWordscapes Answers

NYT Games

WordleConnectionsStrandsSpelling Bee

LinkedIn Games

PinpointCrossclimb

Apple Arcade

Crossword Jam+Wurdweb

Tools

AI Anagram SolverAI Word Problem SolverBoard SolverHangman SolverCryptogram SolverAnagram Circle SolverName Anagram GeneratorFunny Anagram GeneratorEmoji TranslatorPhrase UnscramblerWord Search MakerScrabble CalculatorWord CounterInteractive Letter BankProgressive Hint HelperWaffle Solver

Word Lists

5 Letter WordsBrowse DictionaryAll Word Lists
View all tools and word lists →

Following

/ˈfɒləʊɪŋ/

Scrabble:16 ptsWWF:20 pts9 letters
Definition of Following

verb

  1. To go after; to pursue; to move behind in the same path or direction.

    "Follow that car!"

  2. To go or come after in a sequence.

    "B follows A in the alphabet."

  3. To carry out (orders, instructions, etc.).

    "Follow these instructions to the letter."

  4. To live one's life according to (religion, teachings, etc).
  5. To understand, to pay attention to.

    "Do you follow me?"

noun

  1. A group of followers, attendants or admirers; an entourage.

    "He had a loyal following."

  2. Vocation; business; profession.
  3. (with definite article, treated as singular or plural) A thing or things to be mentioned immediately after.

    "The following are the three most important questions."

adjective

  1. Coming next, either in sequence or in time.

    "See the following section."

  2. About to be specified.

    "The following words have no definition [...]"

  3. (of a wind) Blowing in the direction of travel.

    "The following wind sped us on our way."

preposition

  1. After, subsequent to.

    "Following the meeting, we all had a chat."

Anagrams of Following

No exact anagrams found for "following". This word has a unique letter combination.

+1 Letter Anagrams

Words formed by adding one letter to "following" and rearranging:

+sfollowings
Related Word Patterns
FO...Words starting with "fo"...NGWords ending with "ng"All 9-letter wordsUnscramble "following"
Synonyms & Antonyms
Letter Values
f4
o1
l1
l1
o1
w4
i1
n1
g2

Total: 16 Scrabble points

Word Tools
Find Anagrams of "following"All 9-Letter WordsWords Starting With "F"
Rhymes With Following
aahingabandoningabashingabasingabatingabbreviatingabdicatingabducingabductingabeggingabettingabhorring
Related 9-Letter Words
fabaceousfabricantfabricatefabulatedfabulatesfabulatorfabulistsfaceclothfacedownsfaceliftsfacemasksfaceplatefacetiousfacettingfacsimile

Word Validity & Sources

SOWPODS (International Scrabble): Valid
TWL (US/Canada Scrabble): Valid
Words With Friends: Valid
Last verified: December 2024

Dictionary data sourced from SOWPODS (178,691 words), combining TWL (Tournament Word List) and the Collins Scrabble Words dictionary. Definitions from Free Dictionary API and Wordnik.

About the Word "Following"

Following is a 9-letter word that scores 16 points in Scrabble and 20 points in Words With Friends.

Using "Following" in Word Games

When playing Scrabble or Words With Friends, "following" is a high-scoring word.