Daily Hints for Today's Puzzles

Popular Tools

Anagram SolverAI Anagram SolverAI Word Problem SolverBoard SolverHangman SolverCryptogram SolverScrabble Word FinderCrossword SolverWordle SolverName Anagram GeneratorEmoji TranslatorPhrase UnscramblerWordscapes SolverWordscapes Answers

NYT Games

WordleConnectionsStrandsSpelling Bee

LinkedIn Games

PinpointCrossclimb

Apple Arcade

Crossword Jam+Wurdweb

Microsoft Games

Wordament

Tools

Screenshot SolverAI Word Game CoachAI Anagram SolverAI Word Problem SolverReverse DictionaryWord Ladder SolverBoggle SolverWord ExplorerCrossword + Rhyme FinderCode BreakerBoard SolverHangman SolverCryptogram SolverScrabble Board AnalyzerScrabble CalculatorWord Frequency AnalyzerWord CounterRhyme FinderAcrostic HelperAnagram Circle SolverName Anagram GeneratorFunny Anagram GeneratorEmoji TranslatorPhrase UnscramblerWord Search MakerPuzzle CreatorInteractive Letter BankProgressive Hint HelperWaffle Solver

Word Lists

5 Letter WordsBrowse DictionaryAll Word Lists

Play & Practice

Daily ChallengesWord DuelsVocabulary BuilderMy StatsAnagram TrainerDaily Anagram

Resources

Blog
View all tools and word lists →

Following

Last Updated: January 2, 2026 at 12:30 PM

Scrabble:16 ptsWWF:20 pts9 letters

Definition of Following

Adjective

  1. Coming next, either in sequence or in time.

    "See the following section."

  2. About to be specified.

    "The following words have no definition […]"

  3. Blowing in the direction of travel, as opposed to headwind; downwind.

    "The following wind sped us on our way."

Preposition

  1. After, subsequent to.

    "Following the meeting, we all had a chat."

  2. In accordance with; as per.

    "Following all relevant safety instructions, administer a dose of the corticosteroid."

Noun

  1. A group of followers, attendants or admirers; an entourage.

    "He had a loyal following."

  2. Vocation; business; profession.
  3. A thing or things to be mentioned immediately after.

    "The following is a recommendation letter from the president."

  4. An account which is followed.

Verb

  1. present participle and gerund of follow

Anagrams of Following

Words You Can Make

50 words can be made from the letters in "following":

+1 Letter Anagrams

Words formed by adding one letter to "following" and rearranging:

+sfollowings

Related Word Patterns

FO...Words starting with "fo"...NGWords ending with "ng"All 9-letter wordsUnscramble "following"

Rhyming Words

aahingabandoningabashingabasingabatingabbreviatingabdicatingabducingabductingabeggingabettingabhorringabidingabjuringablating+5 more

Related Words

fabaceousfabricantfabricatefabulatedfabulatesfabulatorfabulistsfaceclothfacedownsfaceliftsfacemasksfaceplatefacetiousfacettingfacsimile
Following - Definition, Anagrams & Scrabble Score | AnagramSolver.com